SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00984 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN00984
Domain Number - Region: 83-138
Classification Level Classification E-value
Superfamily RNI-like 0.0785
Family Rna1p (RanGAP1), N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00984
Sequence length 234
Comment (Caenorhabditis brenneri)
Sequence
MTLNVSDAEAFRRTIQSVESAEEIKELNVHGPSWHRTPVYQDEVAKLVLDECRRAKKLRL
AIYTSKNFVYPTTAMPFNFDLINVTSAHWVPREHFIKLFLSCKKVHLQRKNFTDEDLTAI
FKAWTEDSRLEYLQLNGLWNFYQGKTLGSVFEEFPGAAPVRKAIVPVELFKDSLVVKFGE
GKCYWIQQRDGKTTALVYLFFQTITLSTNFRIGKEVDEMAAQIDEEQNPLGMFF
Download sequence
Identical sequences G0NCQ9
135651.CBN00984 CBN00984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]