SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN01294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN01294
Domain Number 1 Region: 160-224
Classification Level Classification E-value
Superfamily POZ domain 0.000000002
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 41-104
Classification Level Classification E-value
Superfamily POZ domain 0.000000706
Family BTB/POZ domain 0.003
Further Details:      
 
Weak hits

Sequence:  135651.CBN01294
Domain Number - Region: 235-276
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00353
Family Skp1 dimerisation domain-like 0.0077
Further Details:      
 
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.034
Family Skp1 dimerisation domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN01294
Sequence length 290
Comment (Caenorhabditis brenneri)
Sequence
MIIHANVIVNNIGLLLLPSFFCGYHEAAEVRATCYPNEMSLYNISSDDGRNFRVSADAVK
HSESFMECISVNKIAANSRAVSEHSVSGAILDRIIPWCEHHKYGNVPNKVTEWDRTHLTS
KNRKDRMNLVLAASLLKMKDLKRMSIQLFCEQETSQDTGFIHLQSKDGRAFQMSLNAAKQ
SLLLAQILENLSGKSPVFPITVDSTSAQLDILVKWCEYHKGEPIPVMDPRQNPFDATVPQ
FDKDLLRFGNQKMMEIIGAGAALEINGFVKNATKTWIGKELSVERLSAMF
Download sequence
Identical sequences G0NLZ1
135651.CBN01294 CBN01294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]