SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN02144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN02144
Domain Number 1 Region: 24-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-71
Family Calponin-homology domain, CH-domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 3781-3932
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-22
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 3 Region: 4685-4761
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.42e-22
Family GAS2 domain 0.00063
Further Details:      
 
Domain Number 4 Region: 1136-1257,1290-1315
Classification Level Classification E-value
Superfamily Spectrin repeat 9e-19
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 663-792,853-877
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-17
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 6 Region: 4006-4155
Classification Level Classification E-value
Superfamily Spectrin repeat 8.54e-17
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 4219-4374
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000123
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 4328-4470
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 3558-3716
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000226
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 10 Region: 2917-3059
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000979
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 11 Region: 2842-2953
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000017
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 12 Region: 3011-3168
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000746
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 13 Region: 2045-2201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000758
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 14 Region: 3343-3497
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 15 Region: 267-377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000532
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 16 Region: 3913-4010
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000198
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 17 Region: 3224-3346
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000008
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 18 Region: 963-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000011
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 19 Region: 1832-1984
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 20 Region: 4425-4571
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000624
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 21 Region: 2267-2411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 22 Region: 503-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000183
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 23 Region: 2576-2732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000048
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 24 Region: 4601-4678
Classification Level Classification E-value
Superfamily EF-hand 0.00000497
Family Polcalcin 0.063
Further Details:      
 
Domain Number 25 Region: 1058-1177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000013
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  135651.CBN02144
Domain Number - Region: 1393-1511
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000101
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 787-843
Classification Level Classification E-value
Superfamily SH3-domain 0.00327
Family SH3-domain 0.0022
Further Details:      
 
Domain Number - Region: 2386-2503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00518
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN02144
Sequence length 4902
Comment (Caenorhabditis brenneri)
Sequence
MVGERYRSNQQQKKSADPSDAFEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKT
GLKVDDLFVDLRDGYALIALLEALTGERIIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQ
VSVIRQRLLMESQHEQISAHSSSQVSEALHGSDATSARDALLQWARKVTAGYPRVNVNNF
SSSWRDGLAFNAILHRYRPNAIDWNKISDESVSNRERLDNAFAAAEREFGVSRLLDAEDV
DTNNPDEKSIITYVSSLYNALPHLPELNRLQKVQEEYIEEAHEWREWVVRAIQLVNDRLL
QGTASELIYELQRFRDDDMPPREEQKRRLVLVYDHLEKVMRSTDLFAIPHELSAPELQRV
WLELLSSIDRRFEVLERHRVQEGNSNDIISRLDHGIGIVNEKLDLILKRIEDVESRVDTS
PPAAVERTVTEIIEDLNALEQPINGFFQDVEELKAMQHPEANDFYRRVYGLHQRRTAYLE
RLTNQILVRLGVRTDTLHKENQQRLENMRQTSFSRVEECIEWVRVRMEKLTTMEFLEDLE
TLEHIFEQHKLDNRDIQDFRQNVDECIARQAEVSAEDTYEYCELLRVLESEYQQLRDLSA
GRMLDLDSLIAFVRAAQMELIWVSERERIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELR
EKQYNDVHNQGAALLNQGHPAVRVIEIYLKTMQTQWDWLLALSKCLEEHLRDALNLKSFM
EEAADAEAWIEEQSARLENNYNRTDFSLEEGERFLRELDEIKDILNKYHQVLMALTERCA
SISPLWQRGERIPHPINVTALCDYADQNITIKAGDDVVLLDNSDLIKWTVRDLSGVEGQV
PSVVFRIPPPDARLTAFLNRLLQQFEKLKKLWEKKHRMVRFNMVLNTMRTIQGWDLDTFN
SIDPDQRDAIMKALNDDANKLLSELDPNDPLALRLREELRKTNEHFWNLLNASQKPPEPD
WASQYDQKMSELLRKLEEAWRRLNDAVGKPVPRSSEELERVIHEHKRFEDALQALDGDVA
NVKELFRQLPNPTPTQRVNHDRLNVLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVKQ
HEITLNSFDDLPAALDKLRGTHSQLLEINMVLKQQQTVIDQLNKNVALLRQHVARTRINE
GHHPDVDAIEDEVQKLNVRWENVNSQVSERLLAVERALQTQMPYRSEYETEIKWLDDVEE
TINRLRKPDEIRPEEYQQQLDQLIAMYTHLQEHTQNIEHVNKLGGQFIHEAKIYDAKLGQ
YGDAIVGVHGVDVRSLFRRTKPQPKNGAQIVTEELELLNRRFAQLSSLILERRNTMNVLI
QNWKRQKQENVTQVITFRETEVNGMLDDLTRFRQEIVTTHLSFNPNTQSVDAATKNVEKV
QRSLDTWRDRIKERLDAIDELCREEGDSLSSEQYSALREMRRQLADEYDTVLRTVESIHT
RLNILSALLIEFSSLTSSMQSWMTDRTRLAGDIRQKVCDPISIDEARFEAKSLMEEVIRE
ESRLKTIGHSVLKIEQEIAAMYDDVKASGSDDVPGGISIDEVHETRRRVEDDYSQLLRQC
QDLIQFQHRVYAMNEDHSEQARKADEWLQSLQNDVSNAESSKVPDDARIQKMEELNRMAA
GGSSQLDEVELASRRLLNALEGTNAADDIRARHEELANERRGRHQQVLERLQQNMMEAAS
KKAEAEGVKQAAANLKVWCLNTLEKTRRPVELPLTEIALHEARRDEQLLHGDIDNHLALI
EELKKKADEVGDTETLAELGECKKNLERSNSNLKGLHDNIFDAINGLQTVNAEEEKLARS
IDSVGFNIRILKLSEAEAEVERLQAQADNLEKITKSLCDIPNVTGTDAVLQKTKELKRRV
NSCASELQAKKGKIAELDAIDSDFAETKGQLVELIESTDEALKSLEKVSIDKQKLSEQRK
QNQDLSEKLQQGNPLLDDLESLAQKLLQVDGGSGSSGAAQRQLSDVRQRFQKLASELKNR
GEKINMLDSKTTAFSEAEGAVSEYMTKKKEQLVHAPIPTTKDGVRSLLLDLERMDKVGRG
EQRRLEEARLHARELAREASIEKEVQEMNQREKNLVDQWDSLADQFDEARDRARNAEKVL
DEYAQIKKWIEGKKKMMDAIGAPTTDQAMAKSQNGQIQIMKAETESEKPVLDNINSMANE
LISGVSDKENAEELLKMMDVLNRKWHSLESGLNEKKERVEEAAMLGQGLRNVQKELKNEL
GELESNVEKASRMSPNNISDQLAALDSLKSRFGGVDKALEKMKTILESAEDLELDATNIA
EIKEALELTQQKADELERKIENVKKAALNAQNESQELEKKVDDLIGVVNSAENELDQAPP
ISADAQKLSDELKRAEELFQKLIENEGEVSLTKANVVEELKKKPDPELKKKMELLNSKWP
KVLGASRDRKDVIAKAGELVQLFSDSEEALEQRLQKDQSELDELLNSQDPEALDALKLVE
MTMARRLTEVDGLIAVMNRIETAAPGPDANRLRRRADKMADDVKGMAKKARTAGALAQRR
HDFSSKFDRLVDEIKQFSENQKIKIQDAIAKDQMNGERVQSKWNEIEDFWSLKSRELKAV
GDEIKKDGSPDESQNVDQQISGLQNGIDELMDLLKGQNVRLEEKKEAANRVQSESQKLAG
MINSLVADVADLDPIGRSRDELKKQKEEVQNLSGELDKAKTKLLELEAEWEAAVDVGVVA
QPAYEINKATVDELNKVVARAGKRLLQREKKLAETEDEVDKLHEDANQIVTVLDVISSED
ALQNDSQLQDPKHIAEKICQLKESLKPVSEKIDVFNSDCKLMIKTAGPESDVKELDSLLK
RVGNAYSDVVGRISDKEMTVDAAVQQQGRVDDAYRALLNWLEETEEMMENQKKPSADAKV
AKAQLHAYEVLMKHVEDKKPSVDGFKTMIEKIVGNESDSEDKKALLNRNQQIADRYKELL
NSAVDRQRKLLDAVDLAERLQEVTIPLDSWLCAAEKRLQNLAKVPITIEKAEEMLCEQEA
LQNELEHKSDDLKDVLEISPLLSSLVSVEDANTISGQVQQLESRARTLDAGIMKMRPLLE
SFLQQIQDFTLDEKDMVKFVEETEIKLTDLEELPIEPDDLVEQTNILAEIAVSIADRDEM
MANIFEVGKQLAIQGEPEEALIAQKRLDDLKFRYADLMTSADEKIALLAKAIPLSEGFHD
GFDNVMQVLEDMDRDLQTIDEEDPETQAELIFLLEDDIFHKIRPSVDELTALSTQLQALC
SADKADELLANTVGMNKLVNSVADRVARRAERIEMASKQSRAVLDDLQYLIEWFSAARER
IVNGALPSLDLECLKSQLKHQRITNEEANANKVQFRNVSAEAKKVARQLGMEGKEANDKI
SDTVDEGKELVEEVMVLCAERTESLERSKALMEQLTSQFDELNKWLDQMDIELQESASVT
TATSPLELREMHDHNEELARMVAAYRPIIEGFKSDVSALQEILAEDQAPLLGSVAGELVQ
GYEDVREAVRARGHAIDNMMGATIGFGERLETLVSNLQGAADRLKENEGISADPSVLETR
LAENRAIVESLRDKQNAYDALKQTANELLATAPEGDAAAGDVEDKLNRLDKLWKEIEREA
LDRGVVLEDVLEKAKNFWSELDSCQKAVDDLRNRLELVEPATGHPEQLADQQEIMTQVAN
EMERTRPRIEALSIAGQQLSGYVPDDEKAVIENQILNVQSGFSTITGLFAEKKRDLIAAM
DEAMAFHGDLQSLMKWLDEAEKRLMMMSPVEQAKQMNQIGQLLEELHRFKDEVDERGVAK
EQVVATALQLAANAPPHLAATVRQPVAELNGRWTRLNAALAEREHKLESSMLQMGKLSDA
ISQLTAWMDKTKSTLTEFSLPRTAVNLRDIEIAKCKLVVLNNDVHAHQHSVNTVNAAAQQ
YIRTSGGVDSETSNKLEEMNQKWEDIQKLLKSIALEIDISKKEAENVGGEVEKWQRWLEE
TESALQSTKPTGGLPETAEFQLDEFKVLKADIEANSSELDAHLMTTEESLKKDNKQEDTW
LAKTHSGMKIKWNKVKELLVDREKKLQLAYEQAVALESALNDMETWIVDAERKLTDLPPI
SRLPETIEKQLHAHESWMDEVARRKTAMTQHQASGVRMQYYCEKKDGIPIKNRLVSLKHR
VEKISGRSAERAKQLATTRDEVATWQDGLFELSQFVESVIERISPDASTTSSVDKLKSKL
EEVKQAQRDVAAKQTLFDVTKKRGAGLAERATRSEYKQIAMMNDKMNKSWNEMIKKLRDR
LKEAEQAVLEGGVFEESMNDLESWIDEEIERYHRTEDQPVFADIDGVRKLADEETRRSAE
RKTKENGVKTVIKKADALMASGVDEKDSIAQAKDRLVKKWQEVEEAARQRGDSIKEAEQA
AADFDAKAHALLDWLAVEEQKLRSASLDEVENVKEDMNAAKDNYANCIQKGEEILAKCQP
SAEPVLRNWMRVLEARWKEVNEKVDEKEFALLEEEQKAKEQNEQIQKLVKFAAEKREELN
KMIEKPSAQDLDTMDQYLQEFAALDVELRERQPEVDAACKALKKASARNPAAEMLSTEWK
KLWLDAMGLQSSLETQKNLLDEMKRLEGWKWEDWKERYVEWNDHAKARVTDLFRRIDRLH
NGNVPRKVFIEGIMGSKFPTSKMEMEKVADLFDKGDGLINSKEFINALRFDTANRNAKPQ
TDTEKITHEIERQKKTCSCCQPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRIGGGWE
SLDEFLHKHDPCRAKGRLNINMFPEVRPSHALDSMRAFTKNRHAKEIPTTGTPGPVMKIR
EKTDRSVPMSGGLGGTAGYTVTSEHRPSRIPRAPSDMSAGRLSRVGSVSNSKNSLMDSTT
PSRPDSRASSDAGDRQTRIPSLRGRKGQRYAGPHAPGCSSSK
Download sequence
Identical sequences G0NIF2
CBN02144 135651.CBN02144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]