SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN02245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN02245
Domain Number 1 Region: 180-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-34
Family Galectin (animal S-lectin) 0.0013
Further Details:      
 
Domain Number 2 Region: 37-182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-31
Family Galectin (animal S-lectin) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN02245
Sequence length 314
Comment (Caenorhabditis brenneri)
Sequence
MITRTIVCLSLVTLALCQGDASDPKETNYKKFIGEQDYKLPFKTRVSEPLAVGQTIHAVG
TLSEKPTRVDFNFHKGSAKEADLPLHFSIRFNEGILGSGKLIYNTFENGNWSEDEQRISN
PFKAGQEFDLRVRILEGKFQVFANRVEVGVFTQRLPLDGIDHVSIRGDLSKLRLFHYGGR
IFPNPYMAVAGLTPGKRLDISALPKGKRVNINLYRENKEYALQVSIRYNEGAVVRNAMTS
NVWGKEEREGKMPLDKNKVFDITIINEEFSFQLFLNNQRFTTFAHRGSPSDIKTLEIDGD
VEIQTVTINDAPGV
Download sequence
Identical sequences G0NAR0
CBN02245 135651.CBN02245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]