SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN02629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN02629
Domain Number 1 Region: 1181-1321
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-30
Family C-type lectin domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 2020-2209
Classification Level Classification E-value
Superfamily vWA-like 9.58e-20
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 3 Region: 840-900,1180-1194
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000863
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  135651.CBN02629
Domain Number - Region: 1507-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00124
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 373-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 438-600
Classification Level Classification E-value
Superfamily vWA-like 0.0263
Family Integrin A (or I) domain 0.059
Further Details:      
 
Domain Number - Region: 392-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0546
Family Laminin G-like module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN02629
Sequence length 2223
Comment (Caenorhabditis brenneri)
Sequence
MRTWVLVAALAVICLAAERELSHGERAKAVLKSWNPRNEIKYFEPIREQKYRTTDEADLN
LETHHISKRSVGQPHFLAGMATRGCNLPGYTGDTCQYPLCSARNPYIPNNQNTDDVSIDA
TNLANCSTPYVIVVDETMWDIKIQLETDSPLNPTFYLQAENGDLVYPDSDSQRPTSYVAQ
YQFLAPGQYQLGPRADTGSEFCTMLMSSRTQIQVTGGFASGAQAERNDYPTLKYVYFDTE
SVVAVHAQGLDFPGQIQAIGFTGAENHISRYIPIGTRYNCTYPYILERYTCNKNTNNDRG
ENFLQVEGMSNSGYRFRRILSYTCILPPVPTSTVPVPITTPAPLTTCKNGGQLLKDTDGS
SYCYCFGLFAGNDCSQMICANGGFLPEPTSERCQCPEGFTGFHCQNIVCSDTSGFDFNAE
NPTLTLVLRSRTELSAVIEQATTSVQGMVDLLSSEPGYLTNFIVVLFDNGKLLINKRYDS
WDLAMVDLTKAINSAPSNGGCSDVVFSSVAAALSLYPTNKSPIYVITDASPNDSTEKDAI
FQLESYWRAPIYFIYVTPLPNENCNSSPDNTGYRDMVDVAARSGGNTFYFSNRTIVSNFF
YQHMLNTLFRSQLILSGDYSQCSSQNVYKSAAIDLTADMVIVVATGSDLSLIVTNPAGGT
PDFDVVYTDGTNYIWSYNKQVSGQWFFNLKSSQPNSACTFKVYQKKYNFGGMSQYNPDYD
VFWSFATTLSSAAGVLRQPVAGFDAAPVFHISNYPAFISMDRVHANLQIYAIRDGVQTEV
YGSSGMWRDACEFNFYFPPFTCRVPDEVLYFNFFARDNNDMTLQRAGTMYCANVHPNPPP
DHQCQNGGVMNPSNTTCFCTPEFTGTYCQNVVCYNGGTPNGASCLCPPGYAGESCEMAKC
LETGPDPEYIRYGVDMVFAVEITSQSLASLVMLDTNFQEILRDVLMQDRMWIRNFVLVGF
NSTWGGTIASSPANNLTAITAALHNLATSVPADTGCRVKLWEALNDAIFGRQIVPGSFIE
IFQTTPEDEMDQRSLGLFYDMSRAMNINIYGFLSARPQALPNGFACNANLTDYYILFGIV
TGSTGTTYILQAPEISNAVRLIPLQFSNGQVNINAMTDCRHDSGMITYFPVDAYTQTIQL
TVFGYGTQIQVYNGNGVLADALELFYDDFTGQSVYEVRKTCDDGWESFGQYCVKFLATTD
ELMAFPQARNFCATAGGYLVDDLGDDKNNFLSSIAAKTQFWIGLAKGNDGQFYWDRGQGI
TPDLLNQPNTYWAPNEPSNDPTRQCVYFDGRGADTHKAWTTDSCSTPRAFMCQKHRYDAD
HKPNVIGNADLPAGHWYATVKTNPTNGNSPSCSLSVRVQSSLQIVTGFTASIGDDNPQID
PIQDSSNNRLIAYIHSADNENRVPILTDAMLWDFYNGTFYNGMKYQPRYGCQYGWVSQNF
PCPNSDNQNNEFGVLHVGEDEFGNTFQRLTFGHCSPAQITCGNGGIRQGGQCVCTDYWTG
SRCTVPFCVNGGTRNDDQASCSCPSGYTGPNCQYEVCQPNIPQLFSDDRKTLLLVVETTR
QNSATVNQLIANLKAIVTSATSSTPLWFTNFGLVTFDTTGRTFEKFNYTTIDALITDLTA
QSNAISTDGACSMPYLGVLAHLLEHDDVIAMPNSEIFLITPAGPSDLNKYGETMDTLFNT
QAHLHYILSKTANCPTFDGVNNVKDMTWLGYGSSGNILFTDSDNLVSLLNVYLPSLYGAS
VLQDPTGAANYTCSDGSLPWFVPVDANTTFIYVSTSAEFGSLSVKDPLGLAHNIAPAYSV
GDQKIYKIEVDRIGGIWTLQLVNPPGLCLAHVYSTGGAKVYTKFSLPMPVGSNTDLTGAH
QDGRYVQPVAGFENVAVFHLSGNAFHAGQLQYVEIFDIDNNGGATNILRSELYRREQCSY
EYYSDLFTCNGDMIIAFIHGVDENNQKFRRQEVVICNGRNPTTGQPVTGTMSPVTQGTVT
QGPATQATNTQGPVTQQPPATTQTPPQTMPTATSPQNGLAFDIVFLIDGSQSAQNSFDQF
TKFIQTMMVSFDVGMAGARVGLVVVAPDLDDQAPPAAQLNSITSQTILNSNLALLKDNYA
DFDHAGQVLTYNLQVVTSAEYMDPTAGYRPDISNHVLVYITTTTSFYTDPTPSAQSIIAK
KQYGIITVGYGAGFDNGKLQTISGGAACSFTATDFTTLNNQIKPIQQLISNAATNGGVYC
KNN
Download sequence
Identical sequences G0M7I7
CBN02629 135651.CBN02629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]