SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN02698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN02698
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily POZ domain 4.51e-24
Family Tetramerization domain of potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN02698
Sequence length 220
Comment (Caenorhabditis brenneri)
Sequence
MCSPDDTIKLNVGGSSVFQSTHSTLTRFNGYFKILLGAKVPVEKSRFGYIFIDRDPTHFR
LVLNFMRDGDVDLPDSSQEIREVLREAQFYRLDGLVKNCQVKLQNFEIKIEKKLPVLESY
DQVLQVITNPEKPVIIIYFPHGPDGTIDVPFNPTEFIKRSQKDSDIYFKRIEYNTPLPHN
SFAFWQWRIYYKDKSYQHGKSSLDFGKKLDEAVAHFKKNL
Download sequence
Identical sequences G0P031
CBN02698 135651.CBN02698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]