SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN02925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN02925
Domain Number 1 Region: 78-133
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000183
Family Skp1 dimerisation domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000445
Family BTB/POZ domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN02925
Sequence length 170
Comment (Caenorhabditis brenneri)
Sequence
MVVGQRNPVYKIRSCDGQILVVQDWVIAQSKCLSIVFAYQNVPAPPLQTSVCSLVLKKVI
EWCSQHRHDNADQVYRNIPNWDAQFLQDNKEIILHLIEAAFRLEIRGLLSIACKAVSIMS
GRSVRDVKLRLRVGGLGDEDDDFEDDDILEQDEEEDDGDDAERLPPIPAA
Download sequence
Identical sequences G0MBK4
CBN02925 135651.CBN02925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]