SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN03218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN03218
Domain Number - Region: 102-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00144
Family Skp1 dimerisation domain-like 0.008
Further Details:      
 
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily POZ domain 0.0863
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN03218
Sequence length 157
Comment (Caenorhabditis brenneri)
Sequence
MSFLFPLPPPGTVAAPAQPLENAEKYNYYVQIHCSEGRDIITTPNALRKSEKLFSLLPLV
DLDLYPNYIHHLHVDVPCNQMFMIINWCEFHQMEGCVEGPDTWDNAYFMQVSAPQKFRLL
CLANEYGVRELTRCLFRILVRENKTKTIEEQREWLQY
Download sequence
Identical sequences G0PMG9
CBN03218 135651.CBN03218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]