SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN03441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN03441
Domain Number 1 Region: 643-719
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 2 Region: 572-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000979
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN03441
Sequence length 763
Comment (Caenorhabditis brenneri)
Sequence
MNDHEVITLDDDGEDEFEIVEQETPPPLQETPSKRFGRQIESRSPEEVRTMSPRRWKTRD
RGGFQRQNGPMFRSPVRDDGWRRSPMRGDGCRRSPEARSGSMFRSPVRGDDWRRSPEARP
SYSKPRPTSPRFSRYAYREPMDQLMSPTISMSGGGGPVRNSHRRYDHHRQLAGSMPRDQI
PIYLARHEMQCISLNDSSYDQYDDAYHSPSPIRHQGNIFNFHKHSPKNNDYGIQIEGRRS
VFDRISFHENPRIDEYEARLRRLEQERSVEIQRKQQKNQQTENLLRQIEGADQEQDEINL
RLQRILEEKRLRNERNMIKIQEASRRIESDSRRYEPYPSSRSHRGSPRRPSSRSSRFDYS
PDREYRRESRRHLDNSDIGSEPEDRRYSRQRDEEPIILGKGAYKPRRMLTDEEMEAFCPS
TFQRVKDDIEKQIKCSMELDKEPFQCRNLPYYNIILESEKPEEIDRARDVIDDYVLGNME
EELGFQTRVTVAIWLSPRTRTALKNYRNTYSMTGHSEVHRLGRDFAVEVTFSQYNTDPNP
PAMVEGTLENIGLFQKSFERFVDGYYEMMNYKIRTEFDFPMHIFSAFVGSGGCHIKELEK
ETNSKITIFRDRQTIEILAESEEDVEIIKRKIDELNAENRKRLSDAENDDYMYKIAIPKD
LVGKVIGHRGNQLQEVRLKSGARCEMDDEVTGDGRKKTLIVSGSFEQAQMAYHLVNKIMG
LTPEDHEYSFIPADNFGQRRPVYRRTEVLQQRLSQSSISIIST
Download sequence
Identical sequences 135651.CBN03441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]