SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN03806 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN03806
Domain Number 1 Region: 206-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN03806
Sequence length 474
Comment (Caenorhabditis brenneri)
Sequence
MPSCTTPTYGVPAQLDSQSSESPSRSSILTPTSLDGDNSPRKRFPMDSSIPLSDRWAAPR
RDGWSSVRAPPPARLSLHTNHRNVMSPISSAYSQTPNSLLSPAMFNPKSRNLFSPTLPAT
PLSYGKSSTEKSLFSPTTTEPVEVEATVEYLADLVKEKKHLTLFPHMFNNVERLLDDEIG
RVRVALFQTEFPRVDLPEPNGDMVSITEKIYVPKNDYPDYNFVGRILGPRGMTAKQLEQD
TGCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHVKLQAALEQVK
KLLVPAPEGTDELKRKQLMELAIINGTYRPMKSPNPARLMTAVPLLSPTPMRSPGPMLMS
PTGTVPTTTFGGSILSPTLGSSGLLGGNVFDYSLLSPSMFDSFSALQLGSDLTFPKYPTT
TSFVNSFPGLFSSSSSSSNSQNAAQNASQPGNLSPISPTSGDSPSVSSVHNTSF
Download sequence
Identical sequences G0NY40
135651.CBN03806 CBN03806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]