SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN04113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN04113
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily POZ domain 0.000000000314
Family BTB/POZ domain 0.033
Further Details:      
 
Weak hits

Sequence:  135651.CBN04113
Domain Number - Region: 67-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0106
Family Pan module (APPLE domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN04113
Sequence length 132
Comment (Caenorhabditis brenneri)
Sequence
MNYYNVILIDENQKFHVWKEHLVKRCPYVDGLFFGNFEENGKNEVTPQEIPADGFQLFLE
CLKGVLETDGDVVCTVACLLTNKCANWLVSLRSCKFFLGYNYNMENVKVAAIPELTNDEL
EEVTKDRMHDQE
Download sequence
Identical sequences G0MW28
CBN04113 135651.CBN04113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]