SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN04663 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN04663
Domain Number 1 Region: 35-126
Classification Level Classification E-value
Superfamily POZ domain 5.49e-20
Family BTB/POZ domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN04663
Sequence length 126
Comment (Caenorhabditis brenneri)
Sequence
MKPSSTVLWDIFLQQCSNMFMVIQYHLQSTNPGENSEYVKHVSNDNHEFVIRRELAESLE
IFNKMLRTPGGNESNTVYLHMINSRMLSEMCNYLSYHKQYLKKEGAFEIDPRDGYELLLV
AGFFEI
Download sequence
Identical sequences G0P7D1
CBN04663 135651.CBN04663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]