SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN05750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN05750
Domain Number 1 Region: 259-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN05750
Sequence length 394
Comment (Caenorhabditis brenneri)
Sequence
MDGSVVMQQEIYIPQKLKAFMSEPHGAALVAAVEGQYNCSINVVNDVLSVGSIIAGVQAD
ITHIEKILIDAWQKRDVQIVIREAALNASCTHACQTLLPRAYCAVVYFFSADIQRRSRCS
DIIVQQFAAKVSIYGTEYSVNKARELMIECLTEHFGLLEIDIPEAQRTTRMGYGMATNTF
NPQVPPPAVSTASFNMFPMGEPNAILTSTPTSPQKYDEPLMSFDNHLLFPSDFSVPPPQL
PAVHDATISPPRTNNVEKVKQWIPTAEVGKILGNRAAMKKQIEGQFNCVITVHTEIYSPF
GMTSVEIMAQNKEQCRGARDAVLLLMQSHEDKTTAAAASFTDSGINSPTSPSTQSPSTTP
EKRGGPRPFHRSSFRDQPKVMLALTPRKVQSPNE
Download sequence
Identical sequences G0MFS6
CBN05750 135651.CBN05750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]