SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN05779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN05779
Domain Number 1 Region: 14-143
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-32
Family Galectin (animal S-lectin) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN05779
Sequence length 145
Comment (Caenorhabditis brenneri)
Sequence
MIGGGVGISFRNEFFNPQTPVNIPVQGFSNGSRLRLVLLPTNEARFHVNLRTPEDIVLHF
NPRFDEGAVVNNSTQGGGWESEDRHPNPFEQNKIYTLEFVSNGGIITIFINGNHFADFVE
RTPSHGVHLIEIEGGVHVHSAHVSH
Download sequence
Identical sequences G0MYT1
135651.CBN05779 CBN05779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]