SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN06117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN06117
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily POZ domain 2.55e-19
Family BTB/POZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN06117
Sequence length 224
Comment (Caenorhabditis brenneri)
Sequence
MKKQLVSFDDDKDMHDIVLIVGGKKFYCSKINLARHSGVLKSLLIGPYQERDKKEIELKE
VSAIDFNNFLLLIHGASEVDDDNVKGLLELSNRWLAPAVLKRCSEFLMYRSKKSIRARFE
LAAQYGFEDAKKFIIGEISKPSKLSEFLPKDITVFDPTSMALLLEKSLKLHGISPGKKGT
EGHWRYSDDLIRHLWSPNRGSYETMCQERWSSYHPQEDEDELSH
Download sequence
Identical sequences G0MUZ6
CBN06117 135651.CBN06117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]