SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN06207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN06207
Domain Number 1 Region: 135-380
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.55e-85
Family Calponin-homology domain, CH-domain 0.00000959
Further Details:      
 
Domain Number 2 Region: 3763-3891
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-32
Family Pleckstrin-homology domain (PH domain) 0.00087
Further Details:      
 
Domain Number 3 Region: 402-518
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-29
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 4 Region: 1613-1765
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-28
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 5 Region: 1718-1874
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-28
Family Spectrin repeat 0.00074
Further Details:      
 
Domain Number 6 Region: 1400-1554
Classification Level Classification E-value
Superfamily Spectrin repeat 3.54e-28
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 7 Region: 3420-3574
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-24
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 2780-2933
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-23
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 9 Region: 2035-2192
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 10 Region: 3226-3357
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-23
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 1835-1978
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-23
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 12 Region: 2464-2616
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-23
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 3100-3250
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-22
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 14 Region: 805-913
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-21
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 15 Region: 2996-3147
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 16 Region: 2675-2830
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 17 Region: 597-733
Classification Level Classification E-value
Superfamily Spectrin repeat 7.77e-19
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 18 Region: 520-631
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-18
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 19 Region: 2302-2413
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 20 Region: 1041-1140
Classification Level Classification E-value
Superfamily Spectrin repeat 6.96e-16
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 21 Region: 1188-1311
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000468
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 22 Region: 2195-2297
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000547
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 23 Region: 738-840
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000705
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 24 Region: 2919-3004
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000235
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 25 Region: 940-992
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000709
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  135651.CBN06207
Domain Number - Region: 3572-3639
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000561
Family Spectrin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN06207
Sequence length 4169
Comment (Caenorhabditis brenneri)
Sequence
MSYVSFAASYSPGEEKTVRSMNDKVEGYRKEIAPSRENVDFEHLRRTPRDHLPENDYQTT
SNSGLAGEVKPYQYRDYHQHQKHDYYGEGVHDSLGESEDNRDEKMRKYEMQVRVPTTGAP
PVRADANGADQDDFNNETLYFERSRIRTLQDERVHIQKKTFTKWCNSFLNRAGSEIEDLF
TDVGDGILLMKLLEIISGDKLGKPNRGKMRVQKVENLNKVLDFLKKKKIQLENIGAEDIL
DRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENF
TTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDV
TRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWI
RVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSR
KQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWL
RSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDK
VRGMEREIIDRWTQLLALLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGR
HLIGVEDLLGKHDLVDAQINAHGSLLSKLSQTANNYIRHKEEQFDVLQRKLDEVTAQYNT
LVELCRSRRLSLERARSLFQFIQDHEEEMAWLAEKEKLCTTALNCGDISAVPQTTLLYKN
VEMEMQTHWARSKGMIAGGERLVQNGQSKEDIQRRLTQMNQGWERLRVAVDALGNWLSEA
RHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKNDITRL
EEMQSQLANSAFHTATTSQSVQETEEVTVPQIEMSYKYEGNGMRVVKGEILALLEKSTPE
WWRALKRDGTEGYVPANYCKIVPGESVTVTQTTQKTTTTVEGNETKSSVVAERQQKISSD
YRELKRLADVRRRLLSDNIKLLRFYRECDDFERWAKEIEVSLADEPSPEHVAAFRRKFDK
LEADMRTNGGTQLKHINDIANDLISEGHGQSRQIESRQHKINAMWENLERLRKQRAVRLE
ATERVADFDTTCESAREWMLGKFEQLDRNPNDVKSLQNLERDLKPLEDKIAALEKLAAAV
KKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALSDMMGWIEKTR
KGMLEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERSPRMPKVEEQL
QNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESV
ENLLKRHRDLEAKLDAQEARLEAFSHTADDMIKAQHADSAYIEQRRKDVLARREAVRRAA
AQRKKKLEASLEYQEMRREADEVMGWMHEKAKLVASGDDATLAASAIPHRLLKHEAFEAE
IIANESRIQQINKEGDGLIAKKHYESPNVEKIVHQVNSQWGDLKKQVWNKGQRLRQAADQ
KGLDRILEDAHAKLDEMESALNSKDQGLDLRSVKDLLQKHTVLEQEMGLYGNKLAEIENR
GKKMAVEGHYDADKIHSTVGDLLQRYAAMKGPAKRRKGDLDESRLWHQLVFDVDCELQWI
AEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLGQASELVKRHHPASAQ
IKAKSGELEASWTELRRLLRARRAIVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGS
DEDAARKLLAKHRALCEDMTTYRQWLEKLEAKCAELVQSERPHVERFQKRQDELVHEFDA
LSKLAEDRRNALEDAVCLYEYMRESADLEQWIGEQLQTALCEDFAEDYEHLKELQSKFDE
FKQSVKTGSERFTSCETAANAILRRNPPFARDVVKKQEKLRSAWNLLCEYIETRTAKLAV
AEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQQHEALDKETHNAQPRLTKL
VDEAERLKKAYPGGNAEQIGGRQQTLVEEWEELRNATDDRKDMLRAAFDLHTFNGKVRDL
LAWTDLTISDIQSDIHINDLQQAEWLQTEHSRLSHEMDAREPEFTRLVGDGEKMINAQHY
ASEEIKNKTRLLKTALERLRSEWTLRSDYLEQAVQWHAYQREAKQIIASIGSKRTTLRSL
AVGGSVADVESQKKRLDTFEKALSTLDERAAISDRNANKLMNARHMESKNIALWQSKVHE
ELKHLREDIDARHASLRDEFALASFDSDVAQIEAWIDEKTNGVRKARDQFGDSISIEEKM
KRLQTHQALEAEVAANKTIVDQILQRGQQLTNLHRNPKIGDRCHELNTKWSQLAGACSDQ
SRALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGRDMEHCRLLLERLDGTRSDSTVD
EQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLSHYRTELLAAMEVHTFN
RDVEDTDERIHEKISAMKSDDFGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKI
LEKRPPLKETVLDSLKKLEESWKQLSETAETRNDKLNRSYKLYKYLDDVKKTEQWANQVR
NKMTSHQTPKDSAGARKLLEHHHERKAEIDGRADELRQLHEEGQALNQEQPEHKAEVQRA
HKRVQNSEHQLRQTWESEKGSLQKLLEWMLWCDEAVQCEQWLADKENQIARGELGDTSDA
VEMLIKGHSAFEETVRKQSEKIDVLAKNADALVSGGNNYRADIVTRKEEVSARHALLLKS
VAKRKDMLEDSKRYHEFIRHCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSEL
VENEKRLSNVERQGEELVADNHFMSEQVKAQLVELRSGWDELRTKSGLKTQRLREAFELH
SLQRKVEDIEKWLDKVEAELGSEDHGRDMLSTQLLIKKLDTLQTEIAGRSDAVVEMMKKA
RELRVQGSSAADECLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFEWVKAAEEDLEWLS
DKMPLASSAESGDSLQSALSLQKKHAALEKELDTRQSAMNETEKRGRDMIRQRHFALGHI
QKILDRLSTAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRD
QAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDL
CRECARRRTQIVDASKYHKFVRQADDLSDWLREKERTASAEDYGQDLEDCQQIIEQFEST
VRELAAAGERVASVQRTQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGA
RQVHRFDQEADQTLNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQ
VAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLERLRHMQSLQSYFQEY
REMMQWMKNMQTTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQS
SHVLSQEIQEKVEILEKAWEMLCEIWKDRAELYEENMDVQRWKQNAEQLDSWLEERAGLL
GDDWRMVDSVEMAESHLRDFDDFLVTLEAQNEKCEMVKRLTLVEQNFSRLRNKEIDRARI
AEEDQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRPSPSGEEFSTHTMPRKDRKDR
AKTTADFVPGTIQIGDVLASSSTVVPNQSAVEMTKTPSFTTRRTQSIRKGSRWEDMGAID
MKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFIENIAAAPPVYIYGAQ
CEQYPEYAKRKNAFRLLLQDGSEFMFSCPDERQMLEWVAKIKFHAHLTPSNQLKSYSYND
DLLQTTGTDHLPMVAPRRNLGGHDVANRLSHASSVFTTADDVDQHELDYSRGCSSLPRGK
HSGQITVRDCATLPRGFGSDVVESQPTAFFPPSGPLLATPSVLTMSSSSMTANVVPTVVT
RKVGVVRRASRRQSVYAESIYGEVEQAIAEANRVSIKSSNGDHAELRHTIQSHPGSSGYT
ETLMYKEHTSSSYQPMERSMSPRSQQNGEFITWVESNQHNQSMNTPDGRSTSASVVSTPS
NYDDNDSIKSSSKRKGLSSLFKRSSKVSK
Download sequence
Identical sequences G0NGX8
CBN06207 135651.CBN06207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]