SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07178
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.04e-39
Family Galectin (animal S-lectin) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07178
Sequence length 192
Comment (Caenorhabditis brenneri)
Sequence
MHSYHNPGVPTALSIFEPLQDGSTVSVHGHVRHGHHKNFAVELLSGPNIVLHVNFRFHHE
HIVAMNSSFGGMWGPEIRHKNPLHHSEHFHLTIKVHAGYYHIAVNGHHLADYPHRYPYQS
VQAIGLKGDVHVDKVHFEGFHFQRRWDGHIDHGHSGYSAYGTDAYVAPVFIQPNFTPYGA
PPPPVQNYNPYR
Download sequence
Identical sequences G0MXU9
CBN07178 135651.CBN07178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]