SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07357
Domain Number 1 Region: 12-80
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000173
Family BTB/POZ domain 0.0026
Further Details:      
 
Domain Number 2 Region: 137-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000342
Family Erythroid transcription factor GATA-1 0.0054
Further Details:      
 
Domain Number 3 Region: 84-127
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000484
Family Skp1 dimerisation domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07357
Sequence length 195
Comment (Caenorhabditis brenneri)
Sequence
MLNNSAPAPEMYYRIVSSDQRELRVSERALQQSKILGTLISILGYTLEDVERNSAIPLTN
LDGNTLELVFKWCEEHKSDSATGKDFDEKFMNEMDDTKRFYVICAAYYLGIENLVALVWK
SSADRINAPVKVDPTPTTISRKCSRCGSTETCKWRQCRSPNILCNACFIYHRKFNKDRPE
SASVAYEFRKMKKTH
Download sequence
Identical sequences G0MME1
135651.CBN07357 CBN07357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]