SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07406 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07406
Domain Number 1 Region: 101-173
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-23
Family Skp1 dimerisation domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 19-86
Classification Level Classification E-value
Superfamily POZ domain 1.1e-17
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07406
Sequence length 215
Comment (Caenorhabditis brenneri)
Sequence
MSAEAAPVVADAAAPEGMYYRIAGSDGVEFKVSELAIQQSETLNRLVTTMGYTAEDVEKK
DAIPIENIDGATLKLVFEWCEHHKGEAIPEDDDSVPKNVVIPEFDAKLMEIDNMQLFHLI
CAANYLNIKQLLNVSCKKVANMAKGKSPEELRIIFEIPTDEEDEAAEKAAKEAEEKAARE
AAEKKAAEKDTTAKNAEEKNAADKETEKDVQGTSA
Download sequence
Identical sequences G0NQH1
CBN07406 135651.CBN07406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]