SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN07477
Domain Number - Region: 14-39
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0534
Family Galectin (animal S-lectin) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07477
Sequence length 73
Comment (Caenorhabditis brenneri)
Sequence
MSVSSLHRLDSPVYKHRLNPLIIGQLTVNGDVLVNSVEVTAVPEEEEEDFEDDEGVEDED
DQDDENAEKEDVK
Download sequence
Identical sequences G0P0M6
135651.CBN07477 CBN07477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]