SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07566
Domain Number 1 Region: 6-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.77e-43
Family Calponin-homology domain, CH-domain 0.00000271
Further Details:      
 
Domain Number 2 Region: 235-297
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.57e-17
Family EB1 dimerisation domain-like 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07566
Sequence length 309
Comment (Caenorhabditis brenneri)
Sequence
MAAQVVNVYTTASSADNLSRHEMLMWVNDCLQAHFTKIEQLHTGAGYCLFTDFLFPDSIQ
LKKVKWNSRLELDWLSNWKLVQTTWKNLGVEKVIPVDKLIKGKFQDNFEFLQWFKKLFDA
NYDGHEYDPLSARNGEGLPTADGPAGAAKAPVASRMPARTPQKVVTTMRTPAPGAAAPAA
RPAPSRPAARAAAPPTAAPSSKPTASTAAPVRSASTVAAAPPGVDMATFNKLKEELEEVT
RQLTESDNVIASLEKERDFYFSKLRTIEVICQDNESIGNVEVSRVLEVLYETEEGFAPPE
DEVNGAEEF
Download sequence
Identical sequences G0N0M2
135651.CBN07566 CBN07566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]