SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07596 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07596
Domain Number 1 Region: 142-237
Classification Level Classification E-value
Superfamily POZ domain 1.45e-27
Family BTB/POZ domain 0.0057
Further Details:      
 
Domain Number 2 Region: 24-130
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000458
Family MATH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07596
Sequence length 298
Comment (Caenorhabditis brenneri)
Sequence
MSLLSPPKKFVLKHRFPLVPGMVNREKRYGPSEVHFGIPWRIKIQRSGSHFAAFLCCQKT
TENFQVVFEMKIFSVLGIERSRKTSFKILDLKTGNDGYGWDFMKWDDVENHFLIRNSVSM
ECHVELKEVVRPSYRRFDESAKEMSDVVLVVEEQRFHVSKLFLSFQSPYFHSLLLGNFIE
SSSSEIILKDVNPESFQFFLELLHGESSITEDNIESLLHLGDMFDCPTVMRRCEEYLFLF
PGKIELKEKLRLAVQYRMKDVKRQCLQEVKTIADIPDILPIPLRELNLRTAISMLKTL
Download sequence
Identical sequences G0MJS5
135651.CBN07596 CBN07596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]