SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN07848
Domain Number - Region: 428-560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00123
Family MAM domain 0.024
Further Details:      
 
Domain Number - Region: 23-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0396
Family MAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07848
Sequence length 578
Comment (Caenorhabditis brenneri)
Sequence
MHFYLLLYIFSLFLISGVTAKSNLDCDFSDDCCWATTREEEQWEIQSADELDLNEFRKIF
LTGKSRPPPSGNYAIRVENKKKSSLISCAVCSSTGEATVKFRHWQSANAMLKICWQLAGD
GSPTTENCQVARHSKQSKLNTYKFRDIDKNKNFRLVFIVENADAEMDSANEATIIVDRIS
VDYDSCDHAATHEVEGNVTKKRTRHSKTRQKARSSVTLEKLAQKDLKMKETLKKQEDKQA
YLKNVDQQIAKVVDEVNAKQAAAAAASSSAKTIVPASPKTPVDPLTDLLGSGFVDFLDPN
YETNDDEENDESDSEIKDAKKPSVVTTTSAPASLTPSPLKSGSAGKPPVKRVETSKKSID
TNGQIASIHKTLKPVEHLPIRPVTTESVVKFLPKGKPMQVQVQNGVFTLPSQPHTQIPLG
IPSTCSTSGGCLFEKDFCGWTTPAGVTNKFHLKKIHASSFAEAIVPVGELAVMETETKMT
QAHTVIFDALEFSMGTRLIACCLADGQLTCPFSTPSEQTGVLWQFSKFECPINTSKIAFI
CENFGLTESICAVDNIRIHTSTDVFFLEACQKDKLHKS
Download sequence
Identical sequences G0NT43
CBN07848 135651.CBN07848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]