SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN08082 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN08082
Domain Number 1 Region: 72-123
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000263
Family Ovomucoid domain III-like 0.0095
Further Details:      
 
Domain Number 2 Region: 122-177
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000116
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Weak hits

Sequence:  135651.CBN08082
Domain Number - Region: 19-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00166
Family Ovomucoid domain III-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN08082
Sequence length 204
Comment (Caenorhabditis brenneri)
Sequence
MHPNERMKQSSFIDLALLYEGSCCSARYCNMFEQPVCAEGQMYQTICEFEERQCIEFKLF
KNHITMDSSQEKCSCTAPCPTEWNPVCDKKGQTHANFCTFLNSKCYHKNQLNQTLEVDYS
GVCCEDMCSAGQTSLTVCDSEGKTHTDICSFYVAKCRQMRRGTGKKRLQIAGVGPCKPKN
PLFRSFDYFVNRSVNYRQTKTNRV
Download sequence
Identical sequences G0M7M9
135651.CBN08082 CBN08082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]