SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN08906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN08906
Domain Number 1 Region: 6-87
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000795
Family C-type lectin domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN08906
Sequence length 219
Comment (Caenorhabditis brenneri)
Sequence
MVSALLLFLTLPVVFSADPKCPEGFHYFKRVPTAWNNYTKEWCLGVIDGKEDCSNRDFAR
SICINHNATISMPENKHEFEFVANVSGPGATKMNHAIDGQMSPRCVNKYMKHFYFFSEEK
GECNLKRGLFLFDDINTDPSYVLDHAQDHPTGESQHQVNKTTAMVQSIRSCLGIYSAHET
KEYYSRGGFFTEFCFGQQLNEYNIKADYSRTVVCGRPPL
Download sequence
Identical sequences G0N7A4
CBN08906 135651.CBN08906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]