SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN09594 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN09594
Domain Number 1 Region: 21-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-39
Family Calponin-homology domain, CH-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN09594
Sequence length 192
Comment (Caenorhabditis brenneri)
Sequence
MSAFASSDRAEKSGIALEAQQKIYEKYDKNLAGEILQWVQDITGQSFDTHGDADNFVKVF
QDGSVLCNLANALKPGSVKKVNTSTMAFKKMENISFFLKFAEEFVQKSELFQTVDLYEGQ
DPNAVLICLASLARKSEKNFGRSGLGPKEAQGDRREWTDEQLKAGQNVIGLQMGSNKGAT
ASGLNMGNTRHM
Download sequence
Identical sequences G0NK83
135651.CBN09594 CBN09594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]