SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN09759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN09759
Domain Number - Region: 181-258
Classification Level Classification E-value
Superfamily POZ domain 0.00298
Family BTB/POZ domain 0.045
Further Details:      
 
Domain Number - Region: 245-291
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0157
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN09759
Sequence length 325
Comment (Caenorhabditis brenneri)
Sequence
MSERFKCEFQKFPYSILPFIFSDAKNGICRVENFAEHLAAGTFPRIELGRLCGMNWYSKL
KIYEDDNEIYPVIWSDYINPEVEHKVRVYLKLENDSRNDKNNFEKVGKQVLKFDRPAIGF
YTPILEILNLKNGWLKNGALSFEYGIQVKAIIDNNVWIFNFNNKLFNAGAEMVKLNAMRP
LYTHKLLLHFHSEKLARLGNHVLYRWENEKWRELFIDLLQLCHGVRLHLTLRKYGEILDD
AHSLKMFNIISYCDWYLVETKSWERLKENGKDWIFSAIEYNLRHFLASLVKSMTSLKEHV
SEKDVEKMSNESMKMFVAKFLYEKF
Download sequence
Identical sequences G0NIU2
135651.CBN09759 CBN09759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]