SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN10312 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN10312
Domain Number 1 Region: 113-183
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 
Weak hits

Sequence:  135651.CBN10312
Domain Number - Region: 63-130
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.0471
Family Copper amine oxidase, domain N 0.03
Further Details:      
 
Domain Number - Region: 227-403
Classification Level Classification E-value
Superfamily LigT-like 0.0942
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN10312
Sequence length 404
Comment (Caenorhabditis brenneri)
Sequence
MNAFPTGTYSINGRNYRNTFYRPKRQTWADGSGQSEIKFEDTPDVYEKEPYIGCHNKPDF
PAVKNMGRERTRNESKDDILEETEDTRIQLINKKKWFAKYDEKISQHTMPVYFDRVFVPK
CFIGKLIGTNRRTLNALENDTQCRIKTPRGGERFPCEISSIVSLECVQRCLDRIDIFIAD
ARKSARVTHFVAFPCDQHEVKENFNTFKQLVIENERVDESCKNPQLFTKSSRLHLTLAVV
RIFDDMDLEKTINAFKTIEQEIRVLIGSSSLLAKLQGIDMMNDDPTQVSVIYANVSGVLI
QNVANHISRRLIEFGIASSEKNSSDCFEEVKLHMTLMNARYSTQSDKSVKRKQTLTFDAT
TILEEHRDFYFGSIPLSEICLCPLGSSSSNSEEFYDKIARIKLV
Download sequence
Identical sequences G0N4L6
CBN10312 135651.CBN10312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]