SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN10464 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN10464
Domain Number - Region: 9-83
Classification Level Classification E-value
Superfamily POZ domain 0.000785
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN10464
Sequence length 145
Comment (Caenorhabditis brenneri)
Sequence
MTETSKPSIYESTFAKSDKTDAVLVVDGKKLHVNKACNKLNLCSKSPTDSFFQPSNEENV
ENVLELADRFSILSVTFYLEPFLTAFSISVCDDIRIGDKYGMTDLIEKRVARLSKEDFKT
LAAQPFFESLSDDTKSGMLYRYMNI
Download sequence
Identical sequences G0MVW8
CBN10464 135651.CBN10464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]