SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN10565 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN10565
Domain Number 1 Region: 142-242
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000015
Family Eukaryotic type KH-domain (KH-domain type I) 0.0079
Further Details:      
 
Weak hits

Sequence:  135651.CBN10565
Domain Number - Region: 100-156
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0327
Family Gametocyte protein Pfg27 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN10565
Sequence length 368
Comment (Caenorhabditis brenneri)
Sequence
MSKTDKKPRGEYEPDWAGEPEEEKKTRKETAKLFGPQKDSEWWDINTFSKEDNPNGLLQE
SSFSSLFPKYREKYIKESWPLIEKALGEHFLKADLDLLEGTMCVRTTRKTWDPYIIMKAR
EVIKLLSRSVPYEQAIRVLEDEIYCEIIKISSMVRNKERFVKRRARLIGNDGATLKALEL
LTQCYVCVQGGTVCAVGPLAGLKQINQIVTDCMKNIHPIYNIKTMMIKRELSKNDDLKDT
NWDPYLPKYRKKVQSATTTKEAKKKKAYKMKPKKEYTPYPPAPVMSKIDKQIESGEYFIR
EHERKLNKKRAKLEASAVKTVEKQKQKLKVYQAKEEAPREKQTTKRPSNAPIDMEKLKKK
AKLSKASK
Download sequence
Identical sequences G0PIW2
CBN10565 135651.CBN10565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]