SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN10817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN10817
Domain Number 1 Region: 17-117
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000000899
Family MATH domain 0.012
Further Details:      
 
Weak hits

Sequence:  135651.CBN10817
Domain Number - Region: 119-173
Classification Level Classification E-value
Superfamily POZ domain 0.00942
Family BTB/POZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN10817
Sequence length 234
Comment (Caenorhabditis brenneri)
Sequence
MSETLVMKCTFENILSMTENAKQYSQEEVHGGVPWDFEIRREKDHLSLYLTCNRSWKFDE
WSVKAEVDFKMNTKNQNYSKTFTQLFTNKNVSWGYLKFAPWEKLEEELKDTDGSLEVEFL
ASQSSHFKTLLMGEEPENLPSLTQHDTVRQLLLMSEWFKADTVTRRCEEFLVQKSDKLPK
RKFDLALTFDLHKLKKHCVQSFHSISEMRTAIPSDLSRIDREFLEELFRKSLSF
Download sequence
Identical sequences G0P3J4
135651.CBN10817 CBN10817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]