SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN11061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN11061
Domain Number 1 Region: 105-176
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 8.11e-23
Family Skp1 dimerisation domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 23-90
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000432
Family BTB/POZ domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN11061
Sequence length 191
Comment (Caenorhabditis brenneri)
Sequence
MSAEDAPVVVVDEAAAPVKDVMYFRFVANDDQEFRISELAIQQSETLDRLVEAMRYTSED
VENKPAIPVGDIDGDTLKLVFQWCENHRGEAIPVDDGSVPKIVEIPEFDAKLMDIDNDRL
FNLICAANFLNVQQLLDVSCKKVANMAIGKSPEELRIIFGIPTDEEDEAAERAAHEAEEQ
AVKEAAKKEPA
Download sequence
Identical sequences G0NL13
135651.CBN11061 CBN11061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]