SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN11654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN11654
Domain Number 1 Region: 316-515
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4e-42
Family Ribonuclease PH domain 1-like 0.0000913
Further Details:      
 
Domain Number 2 Region: 36-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-28
Family Ribonuclease PH domain 1-like 0.00054
Further Details:      
 
Domain Number 3 Region: 477-587
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.01e-21
Family Ribonuclease PH domain 2-like 0.00027
Further Details:      
 
Domain Number 4 Region: 166-246
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000000000772
Family Ribonuclease PH domain 2-like 0.0037
Further Details:      
 
Domain Number 5 Region: 651-730
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000713
Family Cold shock DNA-binding domain-like 0.028
Further Details:      
 
Domain Number 6 Region: 577-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN11654
Sequence length 741
Comment (Caenorhabditis brenneri)
Sequence
MRISQLPLRISKRFHSKEYRLAGQEQSVSVEFEGKSEIELKTGHIARFASSAVVASSGDN
AVMATVVQRKTKQGDGNGVPLQVEYRPSASAIGRIPTNFLRRELSQSDNEILISRAIDRS
IRPLLPLNSYETQVICKPLVLDENADQIMLGINAASTALHISSAPFNGPLAALRVAMNSR
GDFRINPTQEELHQANLNLIVAMKQNQKTVMIELDCRETRGEELEQALDVAFTNVEKLHL
AMEKLAIDSNIEKDVLPEKSLEKLMTVLDELTRERIYYVMTDSTHDKISRDNEIKAIFQD
VANSSELEKFDREDVSTCYSSLTKKILRETVLSTGIRCDGRKTTEFRPIRIQVDMYKKLH
GCSMFQRGQTQVMSTVTFDSPTAAFHPDSVAQLLGSQRKKSFMLHYEFPSFAINDIGTSR
SLNRREIGHGALAEKALKDLFPKDFPYATRLACQVLESNGSSSMASVCGGSLALFDAGVP
MKNAAAGVAIGLISDEQEPDTKYKVLTDILGIEDYAGDMDFKVAGTKDGFTAAQLDVKND
GLTREQLRESMQAARAGIDHVLKKMNVMRDRPREQFKSTVPIIHSMRIEPHKRVTLFRNN
GYNCKLIEAETGVKISAEDESNLSLLAQNKEKLQKAIDLMNEVLESNTNVDFAFGSIVQA
EIVEVLDRGVFVTLPGSSRRFFMSNAHLSLNPVRHPEVLGLKVGDKMSCNWFGRDEQTGN
VRLSRKTLQGSSPPATSQKKK
Download sequence
Identical sequences G0NBV9
135651.CBN11654 CBN11654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]