SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN11783 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN11783
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 3.66e-17
Family Tetramerization domain of potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN11783
Sequence length 173
Comment (Caenorhabditis brenneri)
Sequence
MSRPRHADDILNINVGGKKYTVRRTDMLADPRSKLAEWFKPGTLKPIATDKGGNYYLDRD
AKCFRHILAYLRLKKEKFVPSLALPSKPDDLAKLVGECEALNLAELKELALDLLQKYQRT
EEQHYVTSYVQVTLRDFESWQFEREQNQIALKKKPTNEEEYQPNSAYDEWDNL
Download sequence
Identical sequences A0A1I7V376 A0A261CSC1 A0A2G5SPU3 A8XR66 E3M2K1 G0MHK1 Q8MQ13
NP_741899.1.50509 XP_002644065.1.8413 XP_003109564.1.11157 F59F3.6 CRE07451 CBN11783 135651.CBN11783 31234.CRE07451 6238.CBG17532 6239.F59F3.6 F59F3.6 CBG17532 F59F3.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]