SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12047 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN12047
Domain Number 1 Region: 33-105
Classification Level Classification E-value
Superfamily SNARE fusion complex 4.23e-16
Family SNARE fusion complex 0.0015
Further Details:      
 
Domain Number 2 Region: 176-248
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000935
Family SNARE fusion complex 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12047
Sequence length 283
Comment (Caenorhabditis brenneri)
Sequence
MSRNPFDNDYKPSYASSNMPVKSYTTMGQHSGEDEADYYEREIERTLQESLDSTERSRRH
LENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQQTQRNLNNLKSFFGGFFKNKLTK
KPAEPSEVPAVPQSKSASRLSETSASISAGGSSASFSGPSGAYGGSGQRTLNESSRNAIK
GTRWEAMDNQIDENLDMMSANLRNLQRLGQDLGKEVDDQNKMLDRIHYKADRNDAIVRDQ
DKQMQRILGTGASTSQTTAESLTPSMDASTKMSLMMKATSLFK
Download sequence
Identical sequences G0MGH6
CBN12047 135651.CBN12047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]