SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12085 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN12085
Domain Number - Region: 128-208
Classification Level Classification E-value
Superfamily POZ domain 0.000235
Family Tetramerization domain of potassium channels 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12085
Sequence length 268
Comment (Caenorhabditis brenneri)
Sequence
MSEVYRIWEDAVQEKSLVLTKESKVQYCYVANYLWFFFVEDKQFHIVACFKDTPAIEYQA
SVKIWFKNEECSYFERTEQFPFDNKTGDDYDIMDPDWISIEVTFRVTKLYGEEYVGPPEN
ESEEDGMVVIVGDQKIFLNMNRIILQSDVLDEVRANSDDVMMTLFEVNPEVFLEMLRVLN
PPYKRISTHYFTELLLLACRFRIHTLLLKLDTFSKTPQYDPNWFTKTAWRKIQRILREDP
CFSIQILENFRCTCHFGESEKNNFRFGL
Download sequence
Identical sequences G0NRH6
CBN12085 135651.CBN12085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]