SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN12646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN12646
Domain Number - Region: 945-1077
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00332
Family MAM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN12646
Sequence length 1095
Comment (Caenorhabditis brenneri)
Sequence
MENVIHSPLDNKRIYTKDNFYINAIRPKEKEAILYESMLIDGKGSINDIDAFFVTAPPAR
TTLAPKRLGDNQLPDFVQVSEGSVKEDEQMVKEKPQRTPSSLKLVKLPPQPTSTVAPFKH
NSPVRRQLVEAPPPPPQPQLLQPSPVRFPAQPWQIPPLHPQQQSTPNPLTQFFQPIQQPQ
PLIPPNPFFPQQSVPQPWTSPPLVQPNPNPIPQPPTRNDSFDPYIPIPVGQPPYQFQQNL
QQPSQTVESHRQPLHPHGFARTFGQQPIPLPSSAAIDTAFNQAKEREFSVFPPNQILKKP
TPPIDYSVDSVAVVTKDQRPPPFVRSIPEKTSEQLRNFVKVHPHVMNNLQKPLIYRGKEM
VIPKMFNFTNAPTPPPIPTRFPQQPLPTQSTAPHAPTQPVSVVASQQSMYFPLMNPNQKL
DLCCRKQRISPICQNLCNYDTFNDKTLVAAFLTNQCPGPQLGQAYDCASSKADHTPCCER
AGLVSFQGGKCMPFCRTHVATPSNVFDYFVCLQVFETIKGCYRDYSATHPNIFGVTAKSN
LDCDFSDDCCWATTREEEQWEIQSADELDLNEFRKIFLTGKSRPPPSGNYAIRVENKKKS
SLISCAVCSSTGEATVKFRHWQSANAMLKICWQLAGDGSPTTENCQVARHSKQSKLNTYK
FRDIDKNKNFRLVFIVENADAEMDSANEATIIVDRISVDYDSCDHAATHEVEGNVTKKRT
RHSKTRQKARSSVTLEKLAQKDLKMKETLKKQEDKQAYLKNVDQQIAKVVDEVNAKQAAA
AAASSSAKTIVPASPKTPVDPLTDLLGSGFVDFLDPNYETNDDEENDESDSEIKDAKKPS
VATTTAAPASLTPSPLKSGSAGKPPVKRVETSKKSIDTNGQIASIHKTLKPVEHLPIRPV
TTESVVKFLPKGKPMQVQVQNGVFTLPSQPHTQIPLGIPSTCSTSGGCLFEKDFCGWTTP
AGVTNKFHLKKIHASSFAEAIVPVGELAVMETETKMTQAHTVIFDALEFSMGTRLIACCL
ADGQLTCPFSTPSEQTGVLWQFSKFECPINTSKIAFICENFGLTESICAVDNIRIHTSTD
VFFLEACQKDKLHKS
Download sequence
Identical sequences G0NP67
135651.CBN12646 CBN12646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]