SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN13284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN13284
Domain Number 1 Region: 10-114
Classification Level Classification E-value
Superfamily POZ domain 3.03e-22
Family BTB/POZ domain 0.0065
Further Details:      
 
Weak hits

Sequence:  135651.CBN13284
Domain Number - Region: 82-185
Classification Level Classification E-value
Superfamily SSO1389-like 0.00107
Family Cas DxTHG 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN13284
Sequence length 195
Comment (Caenorhabditis brenneri)
Sequence
MAETPEPSIYEKAFAKSDVTDAILVVEEKKLHVNKALLSCHSDYFKTLFNSDFKEKSMEE
IPIEDVKLEDFATVLSLVNPIRIEPTNERIAELLKVADRFLLPSAKRQLELFLMTSTHYS
HEKIEWADMYNLDELLKHTLNKFPNKNAFFFLPSSFSQLKEKTKATIFDRFLVVQRKEDP
RANHRSDRGKRPGFG
Download sequence
Identical sequences G0MVV7
135651.CBN13284 CBN13284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]