SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN13321 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN13321
Domain Number 1 Region: 270-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000903
Family Erythroid transcription factor GATA-1 0.019
Further Details:      
 
Domain Number 2 Region: 99-166
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000366
Family BTB/POZ domain 0.0023
Further Details:      
 
Domain Number 3 Region: 180-232
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000301
Family Skp1 dimerisation domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN13321
Sequence length 330
Comment (Caenorhabditis brenneri)
Sequence
MVSTNVAASLASGAVVSSCHVTALLSPKLSKNNTPASNSSNSDAGESSPIDWPPQNSTFF
QPGAFRPVVSTPKVGNCIKWSIDSILDNTPSSAAPEPVFAVQSGDGQVFSVSKKILHKSK
ALQNLAPFMTNYGKGLGQMQVLPLHNFDGRTLKMVFNWCENYTEDPTITGDNLATSLTAS
EFEKKFLDGKDVSQAFNVASAALYLDIESLVRFASDKIAGILDGNETKDLPHTTSGAQPT
STPIQSTPVQFAPMPPTPMPFQSNSLSTPTIKSSHTCSHCGVQQSCKWRNILSPQILCNA
CYIYQRKYNKVRPATAAASYKRRMAEKTID
Download sequence
Identical sequences G0NI21
CBN13321 135651.CBN13321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]