SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN13559 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN13559
Domain Number 1 Region: 739-917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-19
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 2 Region: 532-713
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.98e-18
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 3 Region: 1477-1519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 406-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000252
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 966-1140
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000339
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 6 Region: 159-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 7 Region: 1176-1217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000634
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 126-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000267
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1550-1589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000392
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 203-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000477
Family EGF-type module 0.021
Further Details:      
 
Domain Number 11 Region: 21-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000574
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1363-1400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000224
Family EGF-type module 0.038
Further Details:      
 
Domain Number 13 Region: 286-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.024
Further Details:      
 
Domain Number 14 Region: 1208-1250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000261
Family EGF-type module 0.022
Further Details:      
 
Domain Number 15 Region: 1287-1323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000348
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 1402-1439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000375
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1514-1558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family EGF-type module 0.006
Further Details:      
 
Domain Number 18 Region: 1242-1284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000541
Family EGF-type module 0.041
Further Details:      
 
Domain Number 19 Region: 365-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.021
Further Details:      
 
Domain Number 20 Region: 329-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000672
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 1324-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  135651.CBN13559
Domain Number - Region: 1441-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 473-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 1607-1651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000585
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 55-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00454
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 950-998
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN13559
Sequence length 1717
Comment (Caenorhabditis brenneri)
Sequence
MKYQHFLIVCTLVTNALCDRACSRNTCLNGGTCTVNDETRMFQCECPQGFSGLLCQDNCS
LHCLHGNCLKGTFGEETCQCSEGWMGSLCDILVTDAQKCTPQCDDEERCTKGADGSYFCQ
NTTSPVSSCTTHTCENNGTCVTENGNAKCSCVNGFVGEHCETDVDQCRESFCQNGASCEN
LIGGYNCICLKGYSGKYCEVQDKKNCTANYCQNDGVCNSNSIELTCECPDGFEGDFCETK
SKANDPLIGCTCENPAHVCSLVNGTTQCECPSGFMGSDCKELKARPCDLEPCLNGGHCVD
DGQNLFTCFCLPHWTGVYCGEPVECLVNGSDCKNGGKCVFSLTSTSCECLEGFTGANCEV
SNSYRSHPTCSDIRCQNGGVCKIDAEGEPYCDCPEGYEGPFCEPKSGCTINPCQNGGTCQ
DADGQYFCHCKNGFAGVHCETLEEPSTPIPTLGNFPVLTTSGVDQLSQNEITCEDCVNSS
NCLDTESGLVCVCRSGFFGQKCDQKHNKCAKVVCPAGQTCNQISENNNITAQCGCDIGHF
GQKCEMVTSATFTAKSLYIHQSSKFSLGTSSFENMAYELEFTFRTTVENTHLASSEDILG
EKILTIQLVSGYLVFNVTGNFMTHLLPMKINDAHWYTVSVKGENDNIEVVVLDENSFKLV
QKSLTGQLEVFLTRFGKISGSHHFIGCMADVRVDGELIIFPESKRAIEIRKGCTRSEQCS
RAYCQNEGVCVDHWESSSCKCKPPFLKPNCAYFLPKTTFGHLDQPSIVHLSTSETENHLL
RNQIELSFLMRSGKPDAVLFYIGEKHAADVLTNYLVVKIAGGLISVRYRTGGRREIEFNS
KNRVDDNREHHVQIFVDRNRRQIIIDDLTEASEPITSRMSQEFYVDDIVIGASNVVASDS
EFYKGYLQDIQINHKSVIIHPTSLAIEKIGKLEKTQNVIEGAVSDPMCTSNACKHGECTE
TFNDFTCQCSDGSTGKHCDKVDYCREAKCVEGSKCENAENGHYCVFPITISNGSKLTYSF
DTKSSLSLTNLKFSLRSHSHNGHIFTLTVGTTTLSAYIFKKRFALVNNANQKFDSVIADG
KWHTIELLPFKVTVDGKSYISTTQLFPSESKSEASLFIGEQGQDVVFACLDNFQIGNYPK
LSFTKTVIPTTSETWSLTDKTSVGTGCISTEQCGLFSTCLNGGTCNDIWNKRKCTCPAGF
TGENCEENVNDCKYMDCGKNGYCLDGIDGSSCVCNNGFTGDHCEHATDECEGTDCHNGGR
CVKEGEKVTCKCDGSWMGDHCNVTFTTSCKDSPCQNFGQCMQKTDTAFECNCMDGYSGEL
CEQRDVNECNHYDCYRGHCVMTVSGPACQCELGYTGRFCEKLLNHCSSNTCSTRGTCHPV
WNNTICNCDNNWRGPHCQYPSNACLDFPCNNDGVCRTSEENTFTCECQKFFMGTRCEIEG
SCLKADCVHGECIQLSPEKHTCSCNIGYEGDACDKRIDYCKAGPCLNEASCENKLTGYKC
TCAVGFEGADCEVNIDECAFGHCKNGAKCRDKINDYDCICDGTGYEGRNCTIDINECENP
NNCINGECSNTLGGYKCACKNGFIGPRCSLRNPCTAQIASNNISSVTCVHGKCVNPVVHI
EKNREVAKYECACDRGYTGPTCSQRIKESAMSNISYLFGPIIAVVIVFAILGCLLLFFVI
RGNNAMHGHYSPSSHEFTQNRMAMPTVIKLPPQERLI
Download sequence
Identical sequences G0MIF2
135651.CBN13559 CBN13559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]