SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN14233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN14233
Domain Number 1 Region: 544-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-39
Family SPRY domain 0.0096
Further Details:      
 
Domain Number 2 Region: 476-575
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 263-327
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1-39
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000191
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Weak hits

Sequence:  135651.CBN14233
Domain Number - Region: 202-236
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00241
Family TFIIH p44 subunit cysteine-rich domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN14233
Sequence length 752
Comment (Caenorhabditis brenneri)
Sequence
MEEELKCTICTQFFDDPIILTCGHSLCRMCALKSHQPSTSSGCSSTSSPRPSTPGILSQI
LSSTSSPISPQSAGSSSGASDTMSLCVSDGGDHESDKLSVVSETDSGVVGCGRTSRPSSI
IGPPLSRLHNILTPSTSGVQLLCNACQKPSYFCDENSIVSAPTNLAMQNVIRRYLAAHPN
IKAGPSVSTPTVEEPSSTSSVPQCQLCEGSENRLANVFCEQCDIYYCTPCQTALHPARGP
LAKHTLIQAGDGGRKKSAVINASTTARDLLRCVTHPGEGLTMYCLACKVPVCSRCLQDLR
HANHDVQSLPIACKGQKTELSATLKQLSEKVKDATEEIGKLKGLHDVIRNNCNDFKSNVC
IQIDQLIEQLQMRKEKLMHHVEEQAENKRRILKSQIIRCTGKLAKTSALIRFCAEALNEP
DPTIYMQVSNSLLHRSTSLEFLWHKEIRTKPEIDSDFVLNLDTKHLQYTIQTLDFAQLKV
PSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDDGNFKEVYSGPDTICTI
DGLHFNTVYSARVKSYNSAGESEYSEAICLQTAQVAWFQLTKSPSQRDMILSNECATLSG
STLEYRTILGSIAFSKGVHYWEVTIDRHDGNSDIVIGVAQPAVNRNVMLGKDLHGWSMYV
DGERSWYLHNETHHNRINGGVARGTVVGVKLDCDRGVLEYTINDRKRVYQGDNLAFTNMP
RGLYYPAFSVNANASITVHTGLSCPPSPDGNE
Download sequence
Identical sequences G0MUL5
135651.CBN14233 CBN14233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]