SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN14703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN14703
Domain Number 1 Region: 30-183
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 2 Region: 224-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 176-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 340-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000183
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN14703
Sequence length 390
Comment (Caenorhabditis brenneri)
Sequence
MKQNGRCRKRRLLPEVVFILLLAVFVKPTLSSSKAAPEAQLTDVELKCPEDWIRLGTKCY
LPFNIHQSWPFALTTCQRYGSTLAKIQTGNENQFIASLLSKPGKSTDIKEYWIGLTVEVL
DDDELYVWSDGTPTSRYVGFWRQDQPNHLNGTCALGKVERKDLEWRLETCNLLRRFVCER
AACVQGSYFCSSGSCISESKKCNGYNDCDDGSDEQNCPQAFQPNCRTYEKGESGVLSSPN
YPNSYDPNLNCRHVLEGPINSRIELTIEHFETEPDFDVMTILDGGPAENSTIVIKRLSGS
LDTAQTITSSTNMMIVQFRTDAQSNARGWQLKWRAVPFTCGGHYTAQAYIQSFVSPGYPK
TFSNGAECVWTVETTPGQVVSLVFGHSSIV
Download sequence
Identical sequences G0N238
CBN14703 135651.CBN14703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]