SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN14759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN14759
Domain Number 1 Region: 14-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-38
Family GABARAP-like 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN14759
Sequence length 130
Comment (Caenorhabditis brenneri)
Sequence
MSGNRGGSYISGIVPSFKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRC
KFLVPDHITVAELMSIVRRRLQLHPQQAFFLLVNERSMVSNSMSMSSLYSQERDPDGFVY
MVYTSQPAFG
Download sequence
Identical sequences B2ZFI7
CBN14759 CBN20849 135651.CBN14759 135651.CBN20849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]