SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN14798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN14798
Domain Number 1 Region: 86-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.53e-18
Family Skp1 dimerisation domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 12-72
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000141
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN14798
Sequence length 163
Comment (Caenorhabditis brenneri)
Sequence
MSAETAAPEDKFFVVSDDDQRFEISNEAIKMSATLQNILQGVESGNMKCLPIQSVNGKVL
ELIVKWCEHHKHLDEIDPLDLANPKNLKMDEWDVKFFDGMEDMVLFELINAVNFLDIKKL
FVYACRIVSDMAKGLTSDKMRERFGIATDEEDAAAAAGAAIAQ
Download sequence
Identical sequences G0NCH6
CBN14798 135651.CBN14798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]