SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN15214
Domain Number 1 Region: 567-613,666-697
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000043
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 2 Region: 312-395
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 3 Region: 406-499
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000285
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 4 Region: 719-802
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000148
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15214
Sequence length 862
Comment (Caenorhabditis brenneri)
Sequence
MDYFNAGSGGATGNGATDPYSVIPQQFGNGGQPPPQQPVFADYQQDVTTDYETYQQQQQQ
QQQHQYRAAQAAQQSPSMYYQNQVTAAQGSYFPIHSASEHDFLGPQQPAAATATTGQTGA
PYQGRTGANKEFMIQHQQRRGNQSGQQHSQQSQQNTQQQQQQQQNQAGRSQNQQQPQQQQ
MQPQTTQPSHFMQHQLQAAAVQQQQAAAQQMHRLQGAPINPQQFMVPPPAIMQQQQLQQV
QQQQVQQMHQMQLQHQQQQLMQQQAQQQGYQQHQQSQHQQGHHQQNHQNHSQHHNQSHPG
QHHIPHNPMMPMMPRLKDWPIRCVVEGKYQSVIIGPHGSTIKEIAQSTHCRVEFVNLSKR
ERTVLGNNERILTVHGNAEHASKAVSRILHVIQSEALKDDDNVGVDIVLRLRAHNQLCGR
LIGKAGSSIKEIMQKTGTNITVTKYIEPLGGPIGLRQDELLCLMERTIMVRGPSIEAVVQ
AESLISAKLKKCYESDSQLRAQALSAPMPMMMPPVAPPGASGMAVPGPQFYPSPAGVVQV
QHFPPSQHLLHSTANNSFLQPGVLQIHPGVTNLRQVRMWVPDNMIGALIGTKGKNIKMII
RETGSVVKIEAPEEKVQREAEEAEKKKQRAAENGEDERDGAASGDHPQEFLEDNGTVTSS
DAIEEKPKPVSERMVTITGDDLQLLKAQSFVFTKIAETAANMPNSSAESERVHGLKLRTE
VSVPTKIIGKIIGKGGQNVRELQRITGAVVKIPVEERKGGEVHRYEDGYEEDMTMIRTVG
NMYSTHNVQFRLAHLVNDYYHSQEHRQNRSEHKSGRPQSAPSTGGKDGSALKMDKLGQVS
PIAATSNRTTPKSSTSPKAKTP
Download sequence
Identical sequences G0MEA1
135651.CBN15214 CBN15214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]