SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15355 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN15355
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily POZ domain 0.000000000073
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15355
Sequence length 176
Comment (Caenorhabditis brenneri)
Sequence
MNFENPDPNLFDVRFTIDNRTFYFSKKMLARHSPVFEALFKTCQNKDHFDDWQNGLMTAE
DFHIFLNTLHGFRCINDSNVEKQLSLGIASKVDVTVAHCLDWLMGKETMLLEKVKFDLAV
KHNLDGLKKKVLSDIESVGDLDDILPADLATLDHATSTLVLQRILELTGARPKESD
Download sequence
Identical sequences G0MV24
135651.CBN15355 CBN15355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]