SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN15546 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN15546
Domain Number 1 Region: 19-85
Classification Level Classification E-value
Superfamily POZ domain 0.00000000334
Family BTB/POZ domain 0.0056
Further Details:      
 
Weak hits

Sequence:  135651.CBN15546
Domain Number - Region: 101-166
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000105
Family Skp1 dimerisation domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN15546
Sequence length 200
Comment (Caenorhabditis brenneri)
Sequence
MAAEQLDVVPHAADDSPERFYKLVSRDGVEFQVSERAVRHSELLIRLFAILNIGPGNEEA
FMLNYHTGRTLNMLFQWLDHYKDDPILLNNNPEALNNVEVSEFDRNLLGINDYNLLINVM
SAAECFRVRRLFKVVCAILGNLGGDNAREEERRELPVVMEEENEDDDLVADDEDDDFMEA
AERIYASARNYNPDASEREY
Download sequence
Identical sequences G0MX19
135651.CBN15546 CBN15546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]