SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN16142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN16142
Domain Number 1 Region: 137-241
Classification Level Classification E-value
Superfamily POZ domain 8.24e-23
Family BTB/POZ domain 0.0095
Further Details:      
 
Domain Number 2 Region: 7-125
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000196
Family MATH domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN16142
Sequence length 269
Comment (Caenorhabditis brenneri)
Sequence
MTSHSKQFVLTQVVYDFSKLPTHYRGGTKRQYANVGWQIGVAKRDQYFRVRLFCLQPKGD
HPWSISTNFIIRVLSVDGQHLTNAVEYTFAGESTYSFCYYDFPSDTIAKNFVVEDKLIIE
ITVAIGSITGIKKPDVLRDFNVPSAFTDVALKVGEKKFFVSKVYLATQSESFQSLLFGGF
KEASQAEVELKEVDPEAFQIFLELIHIENTLTDSNIEDVLILVDKFLAKNIAHLCEEFLI
NKSQHCIRTKLRIAAQYNFKELKARFPYS
Download sequence
Identical sequences G0MDB8
135651.CBN16142 CBN16142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]