SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17101 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN17101
Domain Number - Region: 38-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000116
Family Galectin (animal S-lectin) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17101
Sequence length 152
Comment (Caenorhabditis brenneri)
Sequence
MTGIDRNTDALWIQLSITGDFKVVLESDENTTPLSITMEDEKIFMSSRLLGEWDNSGRRI
FPAALPAYLVEIEIQFLDFQFLITIGDWKETWQYRTSPEHITSMTVSGYAHVHKSEQTFL
EEEEVFEMDDKGLPEDDSSSMDEADEQEDEDS
Download sequence
Identical sequences G0NB98
CBN17101 135651.CBN17101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]