SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17198
Domain Number 1 Region: 21-183
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-23
Family Calponin-homology domain, CH-domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17198
Sequence length 346
Comment (Caenorhabditis brenneri)
Sequence
MRKLIYVLCKSERSNPPRAPSRDAFPQPVTEETLLSWCQRVTNGYSHVKIADFTKSWKNG
LALCSILHTYRPDLIGDYESLDISNNMSGQISNVKKALDALSMMGITDIPTVDMFLTPDK
KQIEILLQRLRRIFEGCEDGSTPASASDHWISRIFGIMETEEKVVAMIAELRNKKDLEDA
VDYSNIPDEVPSTPQFASQNKSLNQPIDDDDDETETSNMQFERSNVRLTMVTPGVGTYRA
SNRASPSKRDELRQRAREMLEKTVTPSATSNSRKGSDEERRREEVRRLLNEKQQSTAIPS
TSSSPYPTFRRLNGSNTDLRRIELDVHKFKKRDPSPTLVRKQCTVY
Download sequence
Identical sequences G0PLX4
CBN17198 135651.CBN17198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]